Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1356281..1356935 | Replicon | chromosome |
Accession | NZ_CP127314 | ||
Organism | Escherichia coli strain C25 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QRM69_RS06605 | Protein ID | WP_000244781.1 |
Coordinates | 1356528..1356935 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QRM69_RS06600 | Protein ID | WP_000354046.1 |
Coordinates | 1356281..1356547 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM69_RS06580 (1352369) | 1352369..1353802 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
QRM69_RS06585 (1353847) | 1353847..1354158 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QRM69_RS06590 (1354322) | 1354322..1354981 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QRM69_RS06595 (1355058) | 1355058..1356038 | - | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
QRM69_RS06600 (1356281) | 1356281..1356547 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QRM69_RS06605 (1356528) | 1356528..1356935 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QRM69_RS06610 (1356975) | 1356975..1357496 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QRM69_RS06615 (1357608) | 1357608..1358504 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QRM69_RS06620 (1358529) | 1358529..1359239 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRM69_RS06625 (1359245) | 1359245..1360978 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T284139 WP_000244781.1 NZ_CP127314:1356528-1356935 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|