Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1189067..1189901 | Replicon | chromosome |
| Accession | NZ_CP127314 | ||
| Organism | Escherichia coli strain C25 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2VDB0 |
| Locus tag | QRM69_RS05720 | Protein ID | WP_000854688.1 |
| Coordinates | 1189067..1189444 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0H2VAY1 |
| Locus tag | QRM69_RS05725 | Protein ID | WP_001285596.1 |
| Coordinates | 1189521..1189901 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM69_RS05690 (1184616) | 1184616..1185550 | - | 935 | Protein_1098 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QRM69_RS05695 (1185543) | 1185543..1185938 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| QRM69_RS05700 (1186007) | 1186007..1186852 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| QRM69_RS05705 (1187136) | 1187136..1188155 | - | 1020 | WP_000875213.1 | IS110 family transposase | - |
| QRM69_RS05710 (1188369) | 1188369..1188566 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| QRM69_RS05715 (1188583) | 1188583..1189070 | - | 488 | Protein_1103 | DUF5983 family protein | - |
| QRM69_RS05720 (1189067) | 1189067..1189444 | - | 378 | WP_000854688.1 | TA system toxin CbtA family protein | Toxin |
| QRM69_RS05725 (1189521) | 1189521..1189901 | - | 381 | WP_001285596.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM69_RS05730 (1189951) | 1189951..1190595 | - | 645 | WP_000094917.1 | hypothetical protein | - |
| QRM69_RS05735 (1190614) | 1190614..1190835 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QRM69_RS05740 (1190898) | 1190898..1191374 | - | 477 | WP_001186726.1 | RadC family protein | - |
| QRM69_RS05745 (1191390) | 1191390..1191875 | - | 486 | WP_000849564.1 | antirestriction protein | - |
| QRM69_RS05750 (1191930) | 1191930..1192748 | - | 819 | WP_001234616.1 | DUF932 domain-containing protein | - |
| QRM69_RS05755 (1192849) | 1192849..1193082 | - | 234 | WP_001119727.1 | DUF905 family protein | - |
| QRM69_RS05760 (1193161) | 1193161..1193616 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF | 1166018..1191875 | 25857 | |
| - | flank | IS/Tn | - | - | 1187136..1188155 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14014.01 Da Isoelectric Point: 8.5221
>T284138 WP_000854688.1 NZ_CP127314:c1189444-1189067 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13897.70 Da Isoelectric Point: 4.7959
>AT284138 WP_001285596.1 NZ_CP127314:c1189901-1189521 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCAVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDLPWWGLPCAVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VDB0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2VAY1 |