Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1189067..1189901 Replicon chromosome
Accession NZ_CP127314
Organism Escherichia coli strain C25

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2VDB0
Locus tag QRM69_RS05720 Protein ID WP_000854688.1
Coordinates 1189067..1189444 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0H2VAY1
Locus tag QRM69_RS05725 Protein ID WP_001285596.1
Coordinates 1189521..1189901 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM69_RS05690 (1184616) 1184616..1185550 - 935 Protein_1098 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QRM69_RS05695 (1185543) 1185543..1185938 - 396 WP_000208383.1 DUF6088 family protein -
QRM69_RS05700 (1186007) 1186007..1186852 - 846 WP_001280441.1 DUF4942 domain-containing protein -
QRM69_RS05705 (1187136) 1187136..1188155 - 1020 WP_000875213.1 IS110 family transposase -
QRM69_RS05710 (1188369) 1188369..1188566 - 198 WP_000839260.1 DUF957 domain-containing protein -
QRM69_RS05715 (1188583) 1188583..1189070 - 488 Protein_1103 DUF5983 family protein -
QRM69_RS05720 (1189067) 1189067..1189444 - 378 WP_000854688.1 TA system toxin CbtA family protein Toxin
QRM69_RS05725 (1189521) 1189521..1189901 - 381 WP_001285596.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QRM69_RS05730 (1189951) 1189951..1190595 - 645 WP_000094917.1 hypothetical protein -
QRM69_RS05735 (1190614) 1190614..1190835 - 222 WP_000692329.1 DUF987 domain-containing protein -
QRM69_RS05740 (1190898) 1190898..1191374 - 477 WP_001186726.1 RadC family protein -
QRM69_RS05745 (1191390) 1191390..1191875 - 486 WP_000849564.1 antirestriction protein -
QRM69_RS05750 (1191930) 1191930..1192748 - 819 WP_001234616.1 DUF932 domain-containing protein -
QRM69_RS05755 (1192849) 1192849..1193082 - 234 WP_001119727.1 DUF905 family protein -
QRM69_RS05760 (1193161) 1193161..1193616 - 456 WP_000581502.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 1166018..1191875 25857
- flank IS/Tn - - 1187136..1188155 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14014.01 Da        Isoelectric Point: 8.5221

>T284138 WP_000854688.1 NZ_CP127314:c1189444-1189067 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13897.70 Da        Isoelectric Point: 4.7959

>AT284138 WP_001285596.1 NZ_CP127314:c1189901-1189521 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCAVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2VDB0

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2VAY1

References