Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 103273..103820 Replicon plasmid pC5101
Accession NZ_CP127311
Organism Escherichia coli strain C51

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QRM70_RS26150 Protein ID WP_001384452.1
Coordinates 103273..103551 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag QRM70_RS26155 Protein ID WP_000079941.1
Coordinates 103551..103820 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM70_RS26120 (98703) 98703..98963 + 261 WP_000343091.1 hypothetical protein -
QRM70_RS26125 (98960) 98960..99550 + 591 WP_001518980.1 hypothetical protein -
QRM70_RS26130 (99612) 99612..99827 - 216 Protein_106 DUF6404 family protein -
QRM70_RS26135 (99956) 99956..100291 + 336 WP_001080729.1 colicin 1A immunity protein -
QRM70_RS26140 (100313) 100313..102193 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
QRM70_RS26145 (102379) 102379..103227 - 849 WP_001057989.1 3'-5' exonuclease -
QRM70_RS26150 (103273) 103273..103551 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QRM70_RS26155 (103551) 103551..103820 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QRM70_RS26160 (104464) 104464..106214 - 1751 Protein_112 Tn3-like element TnAs1 family transposase -
QRM70_RS26165 (106218) 106218..106610 + 393 WP_001351729.1 isochorismatase family cysteine hydrolase -
QRM70_RS26170 (106748) 106748..107632 + 885 WP_000058717.1 EamA family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sitABCD / tet(A) / dfrA5 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 iutA / iucD / iucC / iucC / iucB / iucB / iucA / iroB / iroC / iroD / iroE / iroN / iroN 1..136357 136357


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T284134 WP_001384452.1 NZ_CP127311:c103551-103273 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT284134 WP_000079941.1 NZ_CP127311:c103820-103551 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References