Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 57193..57794 Replicon plasmid pC5104
Accession NZ_CP127308
Organism Escherichia coli strain C51

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag QRM70_RS24695 Protein ID WP_001216047.1
Coordinates 57193..57573 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QRM70_RS24700 Protein ID WP_001190712.1
Coordinates 57573..57794 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM70_RS24670 (QRM70_24665) 52633..54117 - 1485 WP_000124159.1 hypothetical protein -
QRM70_RS24675 (QRM70_24670) 54117..55310 - 1194 WP_000219604.1 terminase -
QRM70_RS24680 (QRM70_24675) 55397..55849 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
QRM70_RS24685 (QRM70_24680) 55938..56981 - 1044 WP_023351456.1 DUF968 domain-containing protein -
QRM70_RS24690 (QRM70_24685) 57009..57188 - 180 WP_285965577.1 PdcA protein -
QRM70_RS24695 (QRM70_24690) 57193..57573 - 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QRM70_RS24700 (QRM70_24695) 57573..57794 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRM70_RS24705 (QRM70_24700) 57867..58256 - 390 WP_000506726.1 S24 family peptidase -
QRM70_RS24710 (QRM70_24705) 58380..58631 - 252 WP_001283837.1 DNA polymerase III subunit theta -
QRM70_RS24715 (QRM70_24710) 58664..59014 + 351 WP_000551789.1 hypothetical protein -
QRM70_RS24720 (QRM70_24715) 58999..59283 - 285 WP_001142394.1 hypothetical protein -
QRM70_RS24725 (QRM70_24720) 59267..59917 - 651 WP_000057451.1 hypothetical protein -
QRM70_RS24730 (QRM70_24725) 59899..60273 - 375 WP_000988657.1 hypothetical protein -
QRM70_RS24735 (QRM70_24730) 60280..60573 - 294 WP_000269004.1 hypothetical protein -
QRM70_RS24740 (QRM70_24735) 60752..60985 - 234 WP_000517421.1 hypothetical protein -
QRM70_RS24745 (QRM70_24740) 61068..61256 - 189 WP_032352565.1 DUF551 domain-containing protein -
QRM70_RS24750 (QRM70_24745) 61344..61607 - 264 Protein_67 hypothetical protein -
QRM70_RS24755 (QRM70_24750) 61824..61958 - 135 Protein_68 hypothetical protein -
QRM70_RS24760 (QRM70_24755) 61955..62287 - 333 WP_157794728.1 hypothetical protein -
QRM70_RS24765 (QRM70_24760) 62292..62470 - 179 Protein_70 hypothetical protein -
QRM70_RS24770 (QRM70_24765) 62472..62660 - 189 WP_000797279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..93334 93334


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T284129 WP_001216047.1 NZ_CP127308:c57573-57193 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT284129 WP_001190712.1 NZ_CP127308:c57794-57573 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References