Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 57193..57794 | Replicon | plasmid pC5104 |
| Accession | NZ_CP127308 | ||
| Organism | Escherichia coli strain C51 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9Z1Q0 |
| Locus tag | QRM70_RS24695 | Protein ID | WP_001216047.1 |
| Coordinates | 57193..57573 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QRM70_RS24700 | Protein ID | WP_001190712.1 |
| Coordinates | 57573..57794 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM70_RS24670 (QRM70_24665) | 52633..54117 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| QRM70_RS24675 (QRM70_24670) | 54117..55310 | - | 1194 | WP_000219604.1 | terminase | - |
| QRM70_RS24680 (QRM70_24675) | 55397..55849 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
| QRM70_RS24685 (QRM70_24680) | 55938..56981 | - | 1044 | WP_023351456.1 | DUF968 domain-containing protein | - |
| QRM70_RS24690 (QRM70_24685) | 57009..57188 | - | 180 | WP_285965577.1 | PdcA protein | - |
| QRM70_RS24695 (QRM70_24690) | 57193..57573 | - | 381 | WP_001216047.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QRM70_RS24700 (QRM70_24695) | 57573..57794 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QRM70_RS24705 (QRM70_24700) | 57867..58256 | - | 390 | WP_000506726.1 | S24 family peptidase | - |
| QRM70_RS24710 (QRM70_24705) | 58380..58631 | - | 252 | WP_001283837.1 | DNA polymerase III subunit theta | - |
| QRM70_RS24715 (QRM70_24710) | 58664..59014 | + | 351 | WP_000551789.1 | hypothetical protein | - |
| QRM70_RS24720 (QRM70_24715) | 58999..59283 | - | 285 | WP_001142394.1 | hypothetical protein | - |
| QRM70_RS24725 (QRM70_24720) | 59267..59917 | - | 651 | WP_000057451.1 | hypothetical protein | - |
| QRM70_RS24730 (QRM70_24725) | 59899..60273 | - | 375 | WP_000988657.1 | hypothetical protein | - |
| QRM70_RS24735 (QRM70_24730) | 60280..60573 | - | 294 | WP_000269004.1 | hypothetical protein | - |
| QRM70_RS24740 (QRM70_24735) | 60752..60985 | - | 234 | WP_000517421.1 | hypothetical protein | - |
| QRM70_RS24745 (QRM70_24740) | 61068..61256 | - | 189 | WP_032352565.1 | DUF551 domain-containing protein | - |
| QRM70_RS24750 (QRM70_24745) | 61344..61607 | - | 264 | Protein_67 | hypothetical protein | - |
| QRM70_RS24755 (QRM70_24750) | 61824..61958 | - | 135 | Protein_68 | hypothetical protein | - |
| QRM70_RS24760 (QRM70_24755) | 61955..62287 | - | 333 | WP_157794728.1 | hypothetical protein | - |
| QRM70_RS24765 (QRM70_24760) | 62292..62470 | - | 179 | Protein_70 | hypothetical protein | - |
| QRM70_RS24770 (QRM70_24765) | 62472..62660 | - | 189 | WP_000797279.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..93334 | 93334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13574.27 Da Isoelectric Point: 5.1514
>T284129 WP_001216047.1 NZ_CP127308:c57573-57193 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9Z1Q0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |