Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4342615..4343450 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A3U1IU51 |
Locus tag | QRM70_RS21235 | Protein ID | WP_062878386.1 |
Coordinates | 4342615..4342992 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A3T3WTI7 |
Locus tag | QRM70_RS21240 | Protein ID | WP_062878385.1 |
Coordinates | 4343082..4343450 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS21200 (4338229) | 4338229..4339167 | - | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
QRM70_RS21210 (4339638) | 4339638..4339919 | - | 282 | Protein_4115 | DUF4942 domain-containing protein | - |
QRM70_RS21215 (4340201) | 4340201..4341204 | - | 1004 | Protein_4116 | IS110-like element ISSfl8 family transposase | - |
QRM70_RS21220 (4341276) | 4341276..4341836 | - | 561 | Protein_4117 | DUF4942 domain-containing protein | - |
QRM70_RS21225 (4341921) | 4341921..4342118 | - | 198 | WP_000839249.1 | DUF957 domain-containing protein | - |
QRM70_RS21230 (4342130) | 4342130..4342618 | - | 489 | WP_062878387.1 | DUF5983 family protein | - |
QRM70_RS21235 (4342615) | 4342615..4342992 | - | 378 | WP_062878386.1 | TA system toxin CbtA family protein | Toxin |
QRM70_RS21240 (4343082) | 4343082..4343450 | - | 369 | WP_062878385.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QRM70_RS21245 (4343530) | 4343530..4343751 | - | 222 | WP_033878268.1 | DUF987 domain-containing protein | - |
QRM70_RS21250 (4343838) | 4343838..4344314 | - | 477 | WP_001186725.1 | RadC family protein | - |
QRM70_RS21255 (4344330) | 4344330..4344815 | - | 486 | WP_062887690.1 | antirestriction protein | - |
QRM70_RS21260 (4344870) | 4344870..4345688 | - | 819 | Protein_4125 | DUF932 domain-containing protein | - |
QRM70_RS21265 (4345865) | 4345865..4346020 | - | 156 | WP_106422060.1 | DUF905 family protein | - |
QRM70_RS21270 (4346099) | 4346099..4346554 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | csgB / csgD / csgE / csgF / csgG | 4332648..4344815 | 12167 | |
- | flank | IS/Tn | - | - | 4340746..4341204 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.14 Da Isoelectric Point: 7.2922
>T284128 WP_062878386.1 NZ_CP127306:c4342992-4342615 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13565.30 Da Isoelectric Point: 6.7340
>AT284128 WP_062878385.1 NZ_CP127306:c4343450-4343082 [Escherichia coli]
VSDTFSGTTHPNDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLANRAGIRGRFSDADSYHLDQAFPLLMKQLEIMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
VSDTFSGTTHPNDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLANRAGIRGRFSDADSYHLDQAFPLLMKQLEIMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGCVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3U1IU51 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3T3WTI7 |