Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 3982082..3982720 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QRM70_RS19415 | Protein ID | WP_000813794.1 |
Coordinates | 3982544..3982720 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QRM70_RS19410 | Protein ID | WP_001270286.1 |
Coordinates | 3982082..3982498 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS19385 (3977399) | 3977399..3978052 | - | 654 | Protein_3754 | ABC transporter ATP-binding protein | - |
QRM70_RS19395 (3978821) | 3978821..3979189 | - | 369 | Protein_3756 | ABC transporter ATP-binding protein | - |
QRM70_RS19400 (3979207) | 3979207..3980352 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QRM70_RS19405 (3980597) | 3980597..3982003 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
QRM70_RS19410 (3982082) | 3982082..3982498 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QRM70_RS19415 (3982544) | 3982544..3982720 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QRM70_RS19420 (3982942) | 3982942..3983172 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QRM70_RS19425 (3983264) | 3983264..3985225 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QRM70_RS19430 (3985298) | 3985298..3985834 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
QRM70_RS19435 (3985926) | 3985926..3987101 | + | 1176 | Protein_3764 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3987141..3988406 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T284126 WP_000813794.1 NZ_CP127306:c3982720-3982544 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT284126 WP_001270286.1 NZ_CP127306:c3982498-3982082 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|