Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3408925..3409748 | Replicon | chromosome |
| Accession | NZ_CP127306 | ||
| Organism | Escherichia coli strain C51 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QRM70_RS16565 | Protein ID | WP_085543245.1 |
| Coordinates | 3408925..3409290 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QRM70_RS16570 | Protein ID | WP_001295723.1 |
| Coordinates | 3409380..3409748 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM70_RS16535 (3403969) | 3403969..3404373 | + | 405 | WP_000839179.1 | transposase | - |
| QRM70_RS16540 (3404370) | 3404370..3404717 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QRM70_RS16545 (3404766) | 3404766..3405795 | + | 1030 | Protein_3197 | IS66 family transposase | - |
| QRM70_RS16550 (3405949) | 3405949..3407490 | + | 1542 | WP_001518966.1 | IS21-like element ISEc12 family transposase | - |
| QRM70_RS16555 (3407505) | 3407505..3408251 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QRM70_RS16560 (3408339) | 3408339..3408891 | + | 553 | Protein_3200 | IS66 family transposase | - |
| QRM70_RS16565 (3408925) | 3408925..3409290 | - | 366 | WP_085543245.1 | TA system toxin CbtA family protein | Toxin |
| QRM70_RS16570 (3409380) | 3409380..3409748 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM70_RS16575 (3409911) | 3409911..3410132 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QRM70_RS16580 (3410195) | 3410195..3410671 | - | 477 | WP_001186774.1 | RadC family protein | - |
| QRM70_RS16585 (3410687) | 3410687..3411160 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| QRM70_RS16590 (3411502) | 3411502..3412320 | - | 819 | WP_001234729.1 | DUF932 domain-containing protein | - |
| QRM70_RS16595 (3412438) | 3412438..3412633 | - | 196 | Protein_3207 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13720.70 Da Isoelectric Point: 6.9472
>T284120 WP_085543245.1 NZ_CP127306:c3409290-3408925 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHP
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHP
Download Length: 366 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT284120 WP_001295723.1 NZ_CP127306:c3409748-3409380 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|