Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2871199..2871824 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QRM70_RS14030 | Protein ID | WP_000911330.1 |
Coordinates | 2871426..2871824 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QRM70_RS14025 | Protein ID | WP_000450524.1 |
Coordinates | 2871199..2871426 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS14000 (2867002) | 2867002..2867472 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QRM70_RS14005 (2867472) | 2867472..2868044 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QRM70_RS14010 (2868190) | 2868190..2869068 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QRM70_RS14015 (2869085) | 2869085..2870119 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QRM70_RS14020 (2870332) | 2870332..2871045 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QRM70_RS14025 (2871199) | 2871199..2871426 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QRM70_RS14030 (2871426) | 2871426..2871824 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRM70_RS14035 (2871971) | 2871971..2872834 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QRM70_RS14040 (2872849) | 2872849..2874864 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QRM70_RS14045 (2874938) | 2874938..2875636 | + | 699 | WP_000679823.1 | esterase | - |
QRM70_RS14050 (2875746) | 2875746..2875946 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T284118 WP_000911330.1 NZ_CP127306:2871426-2871824 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|