Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2544905..2545488 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QRM70_RS12350 | Protein ID | WP_285965471.1 |
Coordinates | 2545153..2545488 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QRM70_RS12345 | Protein ID | WP_000581937.1 |
Coordinates | 2544905..2545153 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS12335 (2541244) | 2541244..2542545 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QRM70_RS12340 (2542593) | 2542593..2544827 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QRM70_RS12345 (2544905) | 2544905..2545153 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QRM70_RS12350 (2545153) | 2545153..2545488 | + | 336 | WP_285965471.1 | endoribonuclease MazF | Toxin |
QRM70_RS12355 (2545559) | 2545559..2546350 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QRM70_RS12360 (2546578) | 2546578..2548215 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QRM70_RS12365 (2548303) | 2548303..2549601 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
QRM70_RS12370 (2549657) | 2549657..2550019 | - | 363 | WP_000034929.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12214.18 Da Isoelectric Point: 8.4777
>T284117 WP_285965471.1 NZ_CP127306:2545153-2545488 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPVVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVVLADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPVVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVVLADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|