Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
Location | 2449571..2450271 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | QRM70_RS11900 | Protein ID | WP_021571969.1 |
Coordinates | 2449948..2450271 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | QRM70_RS11895 | Protein ID | WP_021571970.1 |
Coordinates | 2449571..2449927 (+) | Length | 119 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS11860 (2445608) | 2445608..2446324 | + | 717 | WP_021571976.1 | WYL domain-containing protein | - |
QRM70_RS11865 (2446360) | 2446360..2446812 | + | 453 | WP_021571975.1 | hypothetical protein | - |
QRM70_RS11870 (2446884) | 2446884..2447357 | + | 474 | WP_021554938.1 | hypothetical protein | - |
QRM70_RS11875 (2447477) | 2447477..2448298 | + | 822 | WP_021571974.1 | DUF932 domain-containing protein | - |
QRM70_RS11880 (2448329) | 2448329..2448772 | + | 444 | WP_021571973.1 | antirestriction protein | - |
QRM70_RS11885 (2448785) | 2448785..2449327 | + | 543 | WP_021571972.1 | DNA repair protein RadC | - |
QRM70_RS11890 (2449324) | 2449324..2449545 | + | 222 | WP_021571971.1 | DUF987 family protein | - |
QRM70_RS11895 (2449571) | 2449571..2449927 | + | 357 | WP_021571970.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QRM70_RS11900 (2449948) | 2449948..2450271 | + | 324 | WP_021571969.1 | TA system toxin CbtA family protein | Toxin |
QRM70_RS11905 (2450713) | 2450713..2452323 | + | 1611 | WP_000676929.1 | glycoside hydrolase family 15 protein | - |
QRM70_RS11910 (2452415) | 2452415..2453402 | + | 988 | Protein_2295 | YscQ/HrcQ family type III secretion apparatus protein | - |
QRM70_RS11915 (2453392) | 2453392..2454057 | + | 666 | Protein_2296 | EscR/YscR/HrcR family type III secretion system export apparatus protein | - |
QRM70_RS11920 (2454067) | 2454067..2454327 | + | 261 | WP_000341004.1 | EscS/YscS/HrcS family type III secretion system export apparatus protein | - |
QRM70_RS11925 (2454329) | 2454329..2455096 | + | 768 | WP_097555019.1 | type III secretion system export apparatus subunit SctT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12404.50 Da Isoelectric Point: 7.8568
>T284116 WP_021571969.1 NZ_CP127306:2449948-2450271 [Escherichia coli]
MKFLPATNMRAAKPCLPPVTIWQMLLSRLLEQHYGLSLNDTPFCDATVIQEHIDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGIMNRN
MKFLPATNMRAAKPCLPPVTIWQMLLSRLLEQHYGLSLNDTPFCDATVIQEHIDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTIIDIMRARRDLGIMNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|