Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2385296..2385950 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | QRM70_RS11610 | Protein ID | WP_000244772.1 |
Coordinates | 2385543..2385950 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QRM70_RS11605 | Protein ID | WP_000354046.1 |
Coordinates | 2385296..2385562 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS11580 (2380584) | 2380584..2381327 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
QRM70_RS11585 (2381384) | 2381384..2382817 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
QRM70_RS11590 (2382862) | 2382862..2383173 | + | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
QRM70_RS11595 (2383337) | 2383337..2383996 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QRM70_RS11600 (2384073) | 2384073..2385053 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QRM70_RS11605 (2385296) | 2385296..2385562 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QRM70_RS11610 (2385543) | 2385543..2385950 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
QRM70_RS11615 (2385990) | 2385990..2386511 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QRM70_RS11620 (2386623) | 2386623..2387519 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QRM70_RS11625 (2387544) | 2387544..2388254 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QRM70_RS11630 (2388260) | 2388260..2389993 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T284115 WP_000244772.1 NZ_CP127306:2385543-2385950 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |