Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1749801..1750601 | Replicon | chromosome |
| Accession | NZ_CP127306 | ||
| Organism | Escherichia coli strain C51 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4NNI0 |
| Locus tag | QRM70_RS08400 | Protein ID | WP_000342449.1 |
| Coordinates | 1750074..1750601 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | QRM70_RS08395 | Protein ID | WP_001277108.1 |
| Coordinates | 1749801..1750067 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM70_RS08375 (1745459) | 1745459..1746127 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| QRM70_RS08380 (1746120) | 1746120..1747178 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| QRM70_RS08385 (1747423) | 1747423..1748277 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| QRM70_RS08390 (1748548) | 1748548..1749651 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| QRM70_RS08395 (1749801) | 1749801..1750067 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| QRM70_RS08400 (1750074) | 1750074..1750601 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| QRM70_RS08405 (1750598) | 1750598..1750981 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| QRM70_RS08410 (1751405) | 1751405..1752513 | + | 1109 | Protein_1609 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| QRM70_RS08415 (1752561) | 1752561..1753487 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QRM70_RS08420 (1753484) | 1753484..1754761 | + | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
| QRM70_RS08425 (1754758) | 1754758..1755525 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T284112 WP_000342449.1 NZ_CP127306:1750074-1750601 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |