Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 150795..151632 | Replicon | chromosome |
Accession | NZ_CP127306 | ||
Organism | Escherichia coli strain C51 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QRM70_RS00950 | Protein ID | WP_000227784.1 |
Coordinates | 151090..151632 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QRM70_RS00945 | Protein ID | WP_001297137.1 |
Coordinates | 150795..151106 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM70_RS00920 (145815) | 145815..146762 | + | 948 | WP_021548571.1 | cytochrome o ubiquinol oxidase subunit II | - |
QRM70_RS00925 (146784) | 146784..148775 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QRM70_RS00930 (148765) | 148765..149379 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
QRM70_RS00935 (149379) | 149379..149708 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QRM70_RS00940 (149720) | 149720..150610 | + | 891 | WP_000971336.1 | heme o synthase | - |
QRM70_RS00945 (150795) | 150795..151106 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QRM70_RS00950 (151090) | 151090..151632 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QRM70_RS00955 (151688) | 151688..152623 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QRM70_RS00960 (153031) | 153031..154395 | + | 1365 | WP_001000978.1 | MFS transporter | - |
QRM70_RS00965 (154523) | 154523..155014 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QRM70_RS00970 (155182) | 155182..156093 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T284105 WP_000227784.1 NZ_CP127306:151090-151632 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|