Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 323860..324514 | Replicon | chromosome |
| Accession | NZ_CP127303 | ||
| Organism | Escherichia coli strain APEC37 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | QRM68_RS03030 | Protein ID | WP_000244777.1 |
| Coordinates | 323860..324267 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QRM68_RS03035 | Protein ID | WP_000354046.1 |
| Coordinates | 324248..324514 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM68_RS03010 (319817) | 319817..321550 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| QRM68_RS03015 (321556) | 321556..322266 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QRM68_RS03020 (322291) | 322291..323187 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QRM68_RS03025 (323299) | 323299..323820 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QRM68_RS03030 (323860) | 323860..324267 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
| QRM68_RS03035 (324248) | 324248..324514 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QRM68_RS03040 (324757) | 324757..325737 | + | 981 | WP_001625883.1 | tRNA-modifying protein YgfZ | - |
| QRM68_RS03045 (325814) | 325814..326473 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QRM68_RS03050 (326637) | 326637..326948 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| QRM68_RS03055 (326993) | 326993..328426 | + | 1434 | WP_021557183.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T284090 WP_000244777.1 NZ_CP127303:c324267-323860 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |