284088

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 57797..58290 Replicon plasmid pAPEC3702
Accession NZ_CP127302
Organism Escherichia coli strain APEC37

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag QRM68_RS01370 Protein ID WP_001230709.1
Coordinates 58036..58290 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag QRM68_RS01365 Protein ID WP_000151456.1
Coordinates 57797..58039 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM68_RS01330 (QRM68_01330) 53194..53895 + 702 WP_000280995.1 StbB family protein -
QRM68_RS01335 (QRM68_01335) 53942..54541 + 600 WP_033544693.1 hypothetical protein -
QRM68_RS01340 (QRM68_01340) 54561..55001 + 441 WP_052993860.1 hypothetical protein -
QRM68_RS01345 (QRM68_01345) 55132..55569 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QRM68_RS01350 (QRM68_01350) 55594..55776 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QRM68_RS01355 (QRM68_01355) 56073..56516 + 444 WP_000068545.1 hypothetical protein -
QRM68_RS01360 (QRM68_01360) 56933..57226 - 294 WP_000673428.1 hypothetical protein -
QRM68_RS01365 (QRM68_01365) 57797..58039 - 243 WP_000151456.1 hypothetical protein Antitoxin
QRM68_RS01370 (QRM68_01370) 58036..58290 - 255 WP_001230709.1 hypothetical protein Toxin
QRM68_RS01375 (QRM68_01375) 58287..58829 - 543 WP_001083904.1 hypothetical protein -
QRM68_RS01380 (QRM68_01380) 58933..59448 - 516 WP_001025393.1 J domain-containing protein -
QRM68_RS01385 (QRM68_01385) 59852..60181 - 330 WP_000855119.1 hypothetical protein -
QRM68_RS01390 (QRM68_01390) 60769..61434 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
QRM68_RS01395 (QRM68_01395) 61508..61792 + 285 WP_001162371.1 hypothetical protein -
QRM68_RS01400 (QRM68_01400) 61810..62406 - 597 WP_000125165.1 ProQ/FINO family protein -
QRM68_RS01405 (QRM68_01405) 62556..62678 - 123 WP_223685802.1 Hok/Gef family protein -
QRM68_RS01410 (QRM68_01410) 62623..62775 - 153 Protein_73 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..66746 66746


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T284088 WP_001230709.1 NZ_CP127302:c58290-58036 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT284088 WP_000151456.1 NZ_CP127302:c58039-57797 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References