Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 14248..14770 Replicon plasmid pAPEC3702
Accession NZ_CP127302
Organism Escherichia coli strain APEC37

Toxin (Protein)


Gene name relE Uniprot ID U9YLU1
Locus tag QRM68_RS01145 Protein ID WP_000638823.1
Coordinates 14489..14770 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID U9Y7J1
Locus tag QRM68_RS01140 Protein ID WP_000121741.1
Coordinates 14248..14499 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM68_RS01095 (QRM68_01095) 9318..9488 + 171 WP_000550720.1 hypothetical protein -
QRM68_RS01100 (QRM68_01100) 9499..9711 + 213 WP_039022940.1 hypothetical protein -
QRM68_RS01105 (QRM68_01105) 9982..10284 + 303 WP_001360345.1 hypothetical protein -
QRM68_RS01110 (QRM68_01110) 10281..10538 + 258 WP_000739144.1 hypothetical protein -
QRM68_RS01115 (QRM68_01115) 10542..11537 + 996 WP_001028541.1 type IV secretion system protein -
QRM68_RS01120 (QRM68_01120) 11543..12186 + 644 Protein_15 type IV secretion system protein -
QRM68_RS01125 (QRM68_01125) 12195..12419 + 225 WP_000713561.1 EexN family lipoprotein -
QRM68_RS01130 (QRM68_01130) 12674..13465 - 792 WP_022645137.1 DUF5710 domain-containing protein -
QRM68_RS01135 (QRM68_01135) 13513..14148 + 636 WP_015059536.1 hypothetical protein -
QRM68_RS01140 (QRM68_01140) 14248..14499 + 252 WP_000121741.1 hypothetical protein Antitoxin
QRM68_RS01145 (QRM68_01145) 14489..14770 + 282 WP_000638823.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRM68_RS01150 (QRM68_01150) 14838..15137 + 300 WP_000835764.1 TrbM/KikA/MpfK family conjugal transfer protein -
QRM68_RS01155 (QRM68_01155) 15140..16375 + 1236 WP_061582503.1 TcpQ domain-containing protein -
QRM68_RS01160 (QRM68_01160) 16381..16818 + 438 WP_000539665.1 type IV pilus biogenesis protein PilM -
QRM68_RS01165 (QRM68_01165) 16937..17335 + 399 WP_001153665.1 hypothetical protein -
QRM68_RS01170 (QRM68_01170) 17356..17940 + 585 WP_001177113.1 lytic transglycosylase domain-containing protein -
QRM68_RS01175 (QRM68_01175) 17940..18230 + 291 WP_000865479.1 conjugal transfer protein -
QRM68_RS01180 (QRM68_01180) 18301..18621 + 321 WP_000362080.1 VirB3 family type IV secretion system protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mcr-1.1 - 1..66746 66746


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10945.79 Da        Isoelectric Point: 10.4997

>T284087 WP_000638823.1 NZ_CP127302:14489-14770 [Escherichia coli]
MIYELAFDHRALKEWQKLGHTVREQFKKKLSERLINPRVPAAKLHGHTDRYKIKLRASGYRLVYQVIDEKVVLLVISVGK
REGSDVYHMADTR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9223.38 Da        Isoelectric Point: 3.9823

>AT284087 WP_000121741.1 NZ_CP127302:14248-14499 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVRVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9YLU1

Antitoxin

Source ID Structure
AlphaFold DB U9Y7J1

References