Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 153078..153703 | Replicon | plasmid pAPEC3701 |
Accession | NZ_CP127301 | ||
Organism | Escherichia coli strain APEC37 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QRM68_RS00845 | Protein ID | WP_000911313.1 |
Coordinates | 153078..153476 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QRM68_RS00850 | Protein ID | WP_000450520.1 |
Coordinates | 153476..153703 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM68_RS00830 (149349) | 149349..149846 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
QRM68_RS00835 (149878) | 149878..150609 | + | 732 | WP_130570567.1 | conjugal transfer complement resistance protein TraT | - |
QRM68_RS00840 (150862) | 150862..153069 | + | 2208 | WP_174407540.1 | type IV conjugative transfer system coupling protein TraD | - |
QRM68_RS00845 (153078) | 153078..153476 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRM68_RS00850 (153476) | 153476..153703 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | vat / vat / iroN / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucC / iucD / iutA | 1..192709 | 192709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T284082 WP_000911313.1 NZ_CP127301:c153476-153078 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|