Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 103034..103559 Replicon plasmid pAPEC3701
Accession NZ_CP127301
Organism Escherichia coli strain APEC37

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QRM68_RS00515 Protein ID WP_001159871.1
Coordinates 103254..103559 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QRM68_RS00510 Protein ID WP_000813630.1
Coordinates 103034..103252 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM68_RS00490 (100007) 100007..100423 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -
QRM68_RS00495 (100420) 100420..100650 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin -
QRM68_RS00500 (101069) 101069..101758 + 690 WP_001513524.1 RES family NAD+ phosphorylase -
QRM68_RS00505 (101789) 101789..102478 - 690 WP_001513525.1 helix-turn-helix domain-containing protein -
QRM68_RS00510 (103034) 103034..103252 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QRM68_RS00515 (103254) 103254..103559 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QRM68_RS00520 (103560) 103560..104289 + 730 Protein_103 site-specific integrase -
QRM68_RS00525 (104989) 104989..105162 + 174 Protein_104 RepB family plasmid replication initiator protein -
QRM68_RS00530 (105252) 105252..105949 + 698 WP_103215986.1 IS1-like element IS1A family transposase -
QRM68_RS00535 (105967) 105967..106170 + 204 Protein_106 IS1 family transposase -
QRM68_RS00540 (106470) 106470..107636 + 1167 WP_001238646.1 plasmid-partitioning protein SopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / vat / iroN / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucC / iucD / iutA 1..192709 192709


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T284078 WP_001159871.1 NZ_CP127301:103254-103559 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT284078 WP_000813630.1 NZ_CP127301:103034-103252 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References