Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 100007..100650 Replicon plasmid pAPEC3701
Accession NZ_CP127301
Organism Escherichia coli strain APEC37

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag QRM68_RS00490 Protein ID WP_001044768.1
Coordinates 100007..100423 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag QRM68_RS00495 Protein ID WP_001261287.1
Coordinates 100420..100650 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM68_RS00475 (95248) 95248..96042 - 795 WP_000544809.1 IS21-like element helper ATPase IstB -
QRM68_RS00480 (96042) 96042..97214 - 1173 WP_000952425.1 IS21-like element ISEc62 family transposase -
QRM68_RS00485 (97707) 97707..99845 + 2139 WP_001513523.1 AAA family ATPase -
QRM68_RS00490 (100007) 100007..100423 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
QRM68_RS00495 (100420) 100420..100650 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QRM68_RS00500 (101069) 101069..101758 + 690 WP_001513524.1 RES family NAD+ phosphorylase -
QRM68_RS00505 (101789) 101789..102478 - 690 WP_001513525.1 helix-turn-helix domain-containing protein -
QRM68_RS00510 (103034) 103034..103252 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
QRM68_RS00515 (103254) 103254..103559 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
QRM68_RS00520 (103560) 103560..104289 + 730 Protein_103 site-specific integrase -
QRM68_RS00525 (104989) 104989..105162 + 174 Protein_104 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / vat / iroN / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucC / iucD / iutA 1..192709 192709


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T284077 WP_001044768.1 NZ_CP127301:c100423-100007 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT284077 WP_001261287.1 NZ_CP127301:c100650-100420 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References