Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 94548..95191 | Replicon | plasmid pAPEC3701 |
| Accession | NZ_CP127301 | ||
| Organism | Escherichia coli strain APEC37 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QRM68_RS00465 | Protein ID | WP_001034044.1 |
| Coordinates | 94548..94964 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | QRM68_RS00470 | Protein ID | WP_088569139.1 |
| Coordinates | 94961..95191 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM68_RS00450 (90951) | 90951..91648 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
| QRM68_RS00455 (91902) | 91902..92924 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| QRM68_RS00460 (92909) | 92909..94473 | - | 1565 | Protein_91 | AAA family ATPase | - |
| QRM68_RS00465 (94548) | 94548..94964 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRM68_RS00470 (94961) | 94961..95191 | - | 231 | WP_088569139.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QRM68_RS00475 (95248) | 95248..96042 | - | 795 | WP_000544809.1 | IS21-like element helper ATPase IstB | - |
| QRM68_RS00480 (96042) | 96042..97214 | - | 1173 | WP_000952425.1 | IS21-like element ISEc62 family transposase | - |
| QRM68_RS00485 (97707) | 97707..99845 | + | 2139 | WP_001513523.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / vat / iroN / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucB / iucC / iucC / iucD / iutA | 1..192709 | 192709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T284076 WP_001034044.1 NZ_CP127301:c94964-94548 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|