Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 31289..31890 | Replicon | plasmid pAPEC201603 |
| Accession | NZ_CP127300 | ||
| Organism | Escherichia coli strain APEC20/16 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | I2USK8 |
| Locus tag | QRM67_RS25780 | Protein ID | WP_001216042.1 |
| Coordinates | 31289..31669 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | I2USI4 |
| Locus tag | QRM67_RS25785 | Protein ID | WP_001190710.1 |
| Coordinates | 31669..31890 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM67_RS25750 (QRM67_25755) | 27365..27673 | + | 309 | WP_000349257.1 | hypothetical protein | - |
| QRM67_RS25755 (QRM67_25760) | 27670..28146 | + | 477 | WP_000861171.1 | hypothetical protein | - |
| QRM67_RS25760 (QRM67_25765) | 28143..28637 | + | 495 | WP_000640905.1 | dUTP diphosphatase | - |
| QRM67_RS25765 (QRM67_25770) | 28652..29353 | + | 702 | WP_061354287.1 | DUF2829 domain-containing protein | - |
| QRM67_RS25770 (QRM67_25775) | 29360..30166 | + | 807 | WP_286005057.1 | hypothetical protein | - |
| QRM67_RS25775 (QRM67_25780) | 30153..31253 | + | 1101 | WP_061354298.1 | hypothetical protein | - |
| QRM67_RS25780 (QRM67_25785) | 31289..31669 | - | 381 | WP_001216042.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QRM67_RS25785 (QRM67_25790) | 31669..31890 | - | 222 | WP_001190710.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QRM67_RS25790 (QRM67_25795) | 31963..32352 | - | 390 | WP_000506730.1 | S24 family peptidase | - |
| QRM67_RS25795 (QRM67_25800) | 32440..32724 | - | 285 | WP_001142392.1 | hypothetical protein | - |
| QRM67_RS25800 (QRM67_25805) | 32708..33457 | - | 750 | WP_000196958.1 | hypothetical protein | - |
| QRM67_RS25805 (QRM67_25810) | 33454..33663 | - | 210 | WP_000190275.1 | hypothetical protein | - |
| QRM67_RS25810 (QRM67_25815) | 33688..33981 | - | 294 | WP_000267999.1 | hypothetical protein | - |
| QRM67_RS25815 (QRM67_25820) | 33968..34267 | - | 300 | WP_044869649.1 | ASCH domain-containing protein | - |
| QRM67_RS25820 (QRM67_25825) | 34267..34527 | - | 261 | WP_089602335.1 | eaa protein | - |
| QRM67_RS25825 (QRM67_25830) | 34524..35036 | - | 513 | WP_286005058.1 | DUF551 domain-containing protein | - |
| QRM67_RS25830 (QRM67_25835) | 35047..35310 | - | 264 | WP_000224214.1 | hypothetical protein | - |
| QRM67_RS25835 (QRM67_25840) | 35312..35530 | - | 219 | WP_001767792.1 | DUF4014 family protein | - |
| QRM67_RS25840 (QRM67_25845) | 35532..36110 | - | 579 | WP_286005059.1 | ead/Ea22-like family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..93835 | 93835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.6406
>T284073 WP_001216042.1 NZ_CP127300:c31669-31289 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELYGSNI
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELYGSNI
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I2USK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A348ERB2 |