Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 31289..31890 Replicon plasmid pAPEC201603
Accession NZ_CP127300
Organism Escherichia coli strain APEC20/16

Toxin (Protein)


Gene name doc Uniprot ID I2USK8
Locus tag QRM67_RS25780 Protein ID WP_001216042.1
Coordinates 31289..31669 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID I2USI4
Locus tag QRM67_RS25785 Protein ID WP_001190710.1
Coordinates 31669..31890 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRM67_RS25750 (QRM67_25755) 27365..27673 + 309 WP_000349257.1 hypothetical protein -
QRM67_RS25755 (QRM67_25760) 27670..28146 + 477 WP_000861171.1 hypothetical protein -
QRM67_RS25760 (QRM67_25765) 28143..28637 + 495 WP_000640905.1 dUTP diphosphatase -
QRM67_RS25765 (QRM67_25770) 28652..29353 + 702 WP_061354287.1 DUF2829 domain-containing protein -
QRM67_RS25770 (QRM67_25775) 29360..30166 + 807 WP_286005057.1 hypothetical protein -
QRM67_RS25775 (QRM67_25780) 30153..31253 + 1101 WP_061354298.1 hypothetical protein -
QRM67_RS25780 (QRM67_25785) 31289..31669 - 381 WP_001216042.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QRM67_RS25785 (QRM67_25790) 31669..31890 - 222 WP_001190710.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QRM67_RS25790 (QRM67_25795) 31963..32352 - 390 WP_000506730.1 S24 family peptidase -
QRM67_RS25795 (QRM67_25800) 32440..32724 - 285 WP_001142392.1 hypothetical protein -
QRM67_RS25800 (QRM67_25805) 32708..33457 - 750 WP_000196958.1 hypothetical protein -
QRM67_RS25805 (QRM67_25810) 33454..33663 - 210 WP_000190275.1 hypothetical protein -
QRM67_RS25810 (QRM67_25815) 33688..33981 - 294 WP_000267999.1 hypothetical protein -
QRM67_RS25815 (QRM67_25820) 33968..34267 - 300 WP_044869649.1 ASCH domain-containing protein -
QRM67_RS25820 (QRM67_25825) 34267..34527 - 261 WP_089602335.1 eaa protein -
QRM67_RS25825 (QRM67_25830) 34524..35036 - 513 WP_286005058.1 DUF551 domain-containing protein -
QRM67_RS25830 (QRM67_25835) 35047..35310 - 264 WP_000224214.1 hypothetical protein -
QRM67_RS25835 (QRM67_25840) 35312..35530 - 219 WP_001767792.1 DUF4014 family protein -
QRM67_RS25840 (QRM67_25845) 35532..36110 - 579 WP_286005059.1 ead/Ea22-like family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..93835 93835


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13651.52 Da        Isoelectric Point: 5.6406

>T284073 WP_001216042.1 NZ_CP127300:c31669-31289 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELYGSNI

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8147.13 Da        Isoelectric Point: 4.7708

>AT284073 WP_001190710.1 NZ_CP127300:c31890-31669 [Escherichia coli]
MQSINFRTARGNLSELLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I2USK8

Antitoxin

Source ID Structure
AlphaFold DB A0A348ERB2

References