Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 60881..61482 | Replicon | plasmid pAPEC201602 |
Accession | NZ_CP127299 | ||
Organism | Escherichia coli strain APEC20/16 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | QRM67_RS25410 | Protein ID | WP_286005028.1 |
Coordinates | 61102..61482 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QRM67_RS25405 | Protein ID | WP_001190712.1 |
Coordinates | 60881..61102 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM67_RS25395 (QRM67_25400) | 59378..59908 | + | 531 | WP_032164697.1 | membrane protein | - |
QRM67_RS25400 (QRM67_25405) | 60162..60548 | + | 387 | WP_286005027.1 | helix-turn-helix transcriptional regulator | - |
QRM67_RS25405 (QRM67_25410) | 60881..61102 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRM67_RS25410 (QRM67_25415) | 61102..61482 | + | 381 | WP_286005028.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QRM67_RS25415 (QRM67_25420) | 61487..61666 | + | 180 | WP_000113018.1 | hypothetical protein | - |
QRM67_RS25420 (QRM67_25425) | 61694..62737 | + | 1044 | WP_104731269.1 | DUF968 domain-containing protein | - |
QRM67_RS25425 (QRM67_25430) | 62826..63278 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
QRM67_RS25430 (QRM67_25435) | 63364..64557 | + | 1194 | WP_104731270.1 | terminase | - |
QRM67_RS25435 (QRM67_25440) | 64599..66041 | + | 1443 | WP_226474765.1 | terminase | - |
QRM67_RS25440 (QRM67_25445) | 66255..66356 | + | 102 | Protein_68 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..102041 | 102041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13614.34 Da Isoelectric Point: 5.6343
>T284072 WP_286005028.1 NZ_CP127299:61102-61482 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELANLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELANLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|