Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4025522..4026359 | Replicon | chromosome |
Accession | NZ_CP127297 | ||
Organism | Escherichia coli strain APEC20/16 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | QRM67_RS19840 | Protein ID | WP_000227784.1 |
Coordinates | 4025817..4026359 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | QRM67_RS19835 | Protein ID | WP_001297137.1 |
Coordinates | 4025522..4025833 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM67_RS19810 (4020542) | 4020542..4021489 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
QRM67_RS19815 (4021511) | 4021511..4023502 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
QRM67_RS19820 (4023492) | 4023492..4024106 | + | 615 | WP_286004879.1 | cytochrome o ubiquinol oxidase subunit III | - |
QRM67_RS19825 (4024106) | 4024106..4024435 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
QRM67_RS19830 (4024447) | 4024447..4025337 | + | 891 | WP_000971336.1 | heme o synthase | - |
QRM67_RS19835 (4025522) | 4025522..4025833 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
QRM67_RS19840 (4025817) | 4025817..4026359 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
QRM67_RS19845 (4026415) | 4026415..4027350 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
QRM67_RS19850 (4027758) | 4027758..4029122 | + | 1365 | WP_001000978.1 | MFS transporter | - |
QRM67_RS19855 (4029250) | 4029250..4029741 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
QRM67_RS19860 (4029909) | 4029909..4030820 | + | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T284067 WP_000227784.1 NZ_CP127297:4025817-4026359 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|