Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3991444..3992062 | Replicon | chromosome |
Accession | NZ_CP127297 | ||
Organism | Escherichia coli strain APEC20/16 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QRM67_RS19670 | Protein ID | WP_001291435.1 |
Coordinates | 3991844..3992062 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QRM67_RS19665 | Protein ID | WP_000344800.1 |
Coordinates | 3991444..3991818 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM67_RS19655 (3986533) | 3986533..3987726 | + | 1194 | WP_286004877.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QRM67_RS19660 (3987749) | 3987749..3990898 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QRM67_RS19665 (3991444) | 3991444..3991818 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QRM67_RS19670 (3991844) | 3991844..3992062 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QRM67_RS19675 (3992234) | 3992234..3992785 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QRM67_RS19680 (3992901) | 3992901..3993371 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QRM67_RS19685 (3993535) | 3993535..3995085 | + | 1551 | WP_001364591.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QRM67_RS19690 (3995127) | 3995127..3995480 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QRM67_RS19700 (3995859) | 3995859..3996170 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QRM67_RS19705 (3996201) | 3996201..3996773 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T284066 WP_001291435.1 NZ_CP127297:3991844-3992062 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT284066 WP_000344800.1 NZ_CP127297:3991444-3991818 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |