Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2939483..2940121 | Replicon | chromosome |
| Accession | NZ_CP127297 | ||
| Organism | Escherichia coli strain APEC20/16 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QRM67_RS14435 | Protein ID | WP_000813794.1 |
| Coordinates | 2939945..2940121 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QRM67_RS14430 | Protein ID | WP_001270286.1 |
| Coordinates | 2939483..2939899 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM67_RS14410 (2934635) | 2934635..2935576 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| QRM67_RS14415 (2935577) | 2935577..2936590 | - | 1014 | WP_078206008.1 | ABC transporter ATP-binding protein | - |
| QRM67_RS14420 (2936608) | 2936608..2937753 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| QRM67_RS14425 (2937998) | 2937998..2939404 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| QRM67_RS14430 (2939483) | 2939483..2939899 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QRM67_RS14435 (2939945) | 2939945..2940121 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QRM67_RS14440 (2940343) | 2940343..2940573 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QRM67_RS14445 (2940665) | 2940665..2942626 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QRM67_RS14450 (2942699) | 2942699..2943235 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QRM67_RS14455 (2943288) | 2943288..2944502 | + | 1215 | WP_071601296.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2944542..2945690 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T284065 WP_000813794.1 NZ_CP127297:c2940121-2939945 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT284065 WP_001270286.1 NZ_CP127297:c2939899-2939483 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|