Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1711450..1712075 | Replicon | chromosome |
Accession | NZ_CP127297 | ||
Organism | Escherichia coli strain APEC20/16 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A8S7SZU1 |
Locus tag | QRM67_RS08260 | Protein ID | WP_000911327.1 |
Coordinates | 1711677..1712075 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QRM67_RS08255 | Protein ID | WP_000450524.1 |
Coordinates | 1711450..1711677 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRM67_RS08230 (1707252) | 1707252..1707722 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QRM67_RS08235 (1707722) | 1707722..1708294 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QRM67_RS08240 (1708440) | 1708440..1709318 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QRM67_RS08245 (1709335) | 1709335..1710369 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QRM67_RS08250 (1710582) | 1710582..1711295 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QRM67_RS08255 (1711450) | 1711450..1711677 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QRM67_RS08260 (1711677) | 1711677..1712075 | + | 399 | WP_000911327.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRM67_RS08265 (1712222) | 1712222..1713085 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QRM67_RS08270 (1713100) | 1713100..1715115 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QRM67_RS08275 (1715189) | 1715189..1715887 | + | 699 | WP_000679823.1 | esterase | - |
QRM67_RS08280 (1715997) | 1715997..1716197 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T284057 WP_000911327.1 NZ_CP127297:1711677-1712075 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMEIIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMEIIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|