Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1269030..1269684 | Replicon | chromosome |
| Accession | NZ_CP127297 | ||
| Organism | Escherichia coli strain APEC20/16 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | QRM67_RS06150 | Protein ID | WP_000244772.1 |
| Coordinates | 1269277..1269684 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | QRM67_RS06145 | Protein ID | WP_000354046.1 |
| Coordinates | 1269030..1269296 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM67_RS06120 (1264318) | 1264318..1265061 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| QRM67_RS06125 (1265118) | 1265118..1266551 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
| QRM67_RS06130 (1266596) | 1266596..1266907 | + | 312 | WP_286004956.1 | N(4)-acetylcytidine aminohydrolase | - |
| QRM67_RS06135 (1267071) | 1267071..1267730 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| QRM67_RS06140 (1267807) | 1267807..1268787 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| QRM67_RS06145 (1269030) | 1269030..1269296 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| QRM67_RS06150 (1269277) | 1269277..1269684 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| QRM67_RS06155 (1269724) | 1269724..1270245 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| QRM67_RS06160 (1270357) | 1270357..1271253 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| QRM67_RS06165 (1271278) | 1271278..1271988 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| QRM67_RS06170 (1271994) | 1271994..1273727 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T284055 WP_000244772.1 NZ_CP127297:1269277-1269684 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |