Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1129098..1129933 | Replicon | chromosome |
| Accession | NZ_CP127297 | ||
| Organism | Escherichia coli strain APEC20/16 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3A6S2N5 |
| Locus tag | QRM67_RS05415 | Protein ID | WP_000854800.1 |
| Coordinates | 1129098..1129475 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3Z2YIX3 |
| Locus tag | QRM67_RS05420 | Protein ID | WP_032178229.1 |
| Coordinates | 1129565..1129933 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRM67_RS05385 (1124506) | 1124506..1125483 | + | 978 | WP_000633220.1 | type II secretion system minor pseudopilin GspK | - |
| QRM67_RS05390 (1125480) | 1125480..1126658 | + | 1179 | WP_000094971.1 | type II secretion system protein GspL | - |
| QRM67_RS05395 (1126660) | 1126660..1127196 | + | 537 | WP_000942786.1 | GspM family type II secretion system protein YghD | - |
| QRM67_RS05400 (1127477) | 1127477..1128319 | - | 843 | Protein_1039 | DUF4942 domain-containing protein | - |
| QRM67_RS05405 (1128404) | 1128404..1128601 | - | 198 | WP_001374283.1 | DUF957 domain-containing protein | - |
| QRM67_RS05410 (1128613) | 1128613..1129101 | - | 489 | WP_000779171.1 | DUF5983 family protein | - |
| QRM67_RS05415 (1129098) | 1129098..1129475 | - | 378 | WP_000854800.1 | TA system toxin CbtA family protein | Toxin |
| QRM67_RS05420 (1129565) | 1129565..1129933 | - | 369 | WP_032178229.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QRM67_RS05425 (1129983) | 1129983..1130627 | - | 645 | WP_001384112.1 | hypothetical protein | - |
| QRM67_RS05430 (1130646) | 1130646..1130867 | - | 222 | WP_073544043.1 | DUF987 domain-containing protein | - |
| QRM67_RS05435 (1130936) | 1130936..1131412 | - | 477 | WP_001186725.1 | RadC family protein | - |
| QRM67_RS05440 (1131428) | 1131428..1131913 | - | 486 | WP_000214415.1 | antirestriction protein | - |
| QRM67_RS05445 (1132005) | 1132005..1132823 | - | 819 | WP_130570001.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14068.13 Da Isoelectric Point: 9.1376
>T284054 WP_000854800.1 NZ_CP127297:c1129475-1129098 [Escherichia coli]
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
MKTLPVLPGQAAGLRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDKPGF
NACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHSEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13823.58 Da Isoelectric Point: 6.3177
>AT284054 WP_032178229.1 NZ_CP127297:c1129933-1129565 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFRARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3A6S2N5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z2YIX3 |