Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3165009..3165696 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | QRF07_RS15105 | Protein ID | WP_003414624.1 |
Coordinates | 3165253..3165696 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | QRF07_RS15100 | Protein ID | WP_003414620.1 |
Coordinates | 3165009..3165266 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS15080 (QRF07_15080) | 3160329..3161183 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
QRF07_RS15085 (QRF07_15085) | 3161239..3162402 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
QRF07_RS15090 (QRF07_15090) | 3162419..3163633 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
QRF07_RS15095 (QRF07_15095) | 3163641..3164882 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
QRF07_RS15100 (QRF07_15100) | 3165009..3165266 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
QRF07_RS15105 (QRF07_15105) | 3165253..3165696 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS15110 (QRF07_15110) | 3165776..3166438 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
QRF07_RS15115 (QRF07_15115) | 3166534..3166725 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
QRF07_RS15120 (QRF07_15120) | 3167057..3168805 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
QRF07_RS15125 (QRF07_15125) | 3168901..3169482 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
QRF07_RS15130 (QRF07_15130) | 3169582..3169848 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T284044 WP_003414624.1 NZ_CP127277:3165253-3165696 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|