Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3118491..3119095 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag QRF07_RS14875 Protein ID WP_003414492.1
Coordinates 3118491..3118883 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag QRF07_RS14880 Protein ID WP_003414495.1
Coordinates 3118880..3119095 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS14845 (QRF07_14845) 3113641..3114429 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
QRF07_RS14850 (QRF07_14850) 3114763..3115308 - 546 WP_014584866.1 DUF1802 family protein -
QRF07_RS14855 (QRF07_14855) 3115580..3116464 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QRF07_RS14860 (QRF07_14860) 3116467..3117354 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
QRF07_RS14865 (QRF07_14865) 3117659..3118204 - 546 WP_003910939.1 DUF1802 family protein -
QRF07_RS14870 (QRF07_14870) 3118201..3118470 - 270 WP_003414489.1 DUF2277 family protein -
QRF07_RS14875 (QRF07_14875) 3118491..3118883 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF07_RS14880 (QRF07_14880) 3118880..3119095 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QRF07_RS14885 (QRF07_14885) 3119142..3119891 + 750 WP_003902358.1 enoyl-CoA hydratase -
QRF07_RS14890 (QRF07_14890) 3119970..3121052 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
QRF07_RS14895 (QRF07_14895) 3121045..3122355 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
QRF07_RS14900 (QRF07_14900) 3122358..3123185 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
QRF07_RS14905 (QRF07_14905) 3123182..3124093 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T284042 WP_003414492.1 NZ_CP127277:c3118883-3118491 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT284042 WP_003414495.1 NZ_CP127277:c3119095-3118880 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References