Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-Phd |
| Location | 3118491..3119095 | Replicon | chromosome |
| Accession | NZ_CP127277 | ||
| Organism | Mycobacterium tuberculosis strain 25421 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P71623 |
| Locus tag | QRF07_RS14875 | Protein ID | WP_003414492.1 |
| Coordinates | 3118491..3118883 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A829CBY8 |
| Locus tag | QRF07_RS14880 | Protein ID | WP_003414495.1 |
| Coordinates | 3118880..3119095 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF07_RS14845 (QRF07_14845) | 3113641..3114429 | - | 789 | WP_003917092.1 | CRISPR-associated endoribonuclease Cas6 | - |
| QRF07_RS14850 (QRF07_14850) | 3114763..3115308 | - | 546 | WP_014584866.1 | DUF1802 family protein | - |
| QRF07_RS14855 (QRF07_14855) | 3115580..3116464 | - | 885 | WP_003414409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QRF07_RS14860 (QRF07_14860) | 3116467..3117354 | - | 888 | WP_003414414.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| QRF07_RS14865 (QRF07_14865) | 3117659..3118204 | - | 546 | WP_003910939.1 | DUF1802 family protein | - |
| QRF07_RS14870 (QRF07_14870) | 3118201..3118470 | - | 270 | WP_003414489.1 | DUF2277 family protein | - |
| QRF07_RS14875 (QRF07_14875) | 3118491..3118883 | - | 393 | WP_003414492.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF07_RS14880 (QRF07_14880) | 3118880..3119095 | - | 216 | WP_003414495.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QRF07_RS14885 (QRF07_14885) | 3119142..3119891 | + | 750 | WP_003902358.1 | enoyl-CoA hydratase | - |
| QRF07_RS14890 (QRF07_14890) | 3119970..3121052 | - | 1083 | WP_003414499.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| QRF07_RS14895 (QRF07_14895) | 3121045..3122355 | - | 1311 | WP_003414501.1 | ABC transporter substrate-binding protein | - |
| QRF07_RS14900 (QRF07_14900) | 3122358..3123185 | - | 828 | WP_003414504.1 | carbohydrate ABC transporter permease | - |
| QRF07_RS14905 (QRF07_14905) | 3123182..3124093 | - | 912 | WP_003414505.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14610.74 Da Isoelectric Point: 6.7594
>T284042 WP_003414492.1 NZ_CP127277:c3118883-3118491 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CBY8 |