Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3092225..3092795 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | QRF07_RS14730 | Protein ID | WP_003414166.1 |
Coordinates | 3092225..3092581 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | QRF07_RS14735 | Protein ID | WP_003901465.1 |
Coordinates | 3092565..3092795 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS14710 (QRF07_14710) | 3087677..3089365 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
QRF07_RS14715 (QRF07_14715) | 3089369..3089695 | - | 327 | WP_003414157.1 | hypothetical protein | - |
QRF07_RS14720 (QRF07_14720) | 3089868..3090455 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
QRF07_RS14725 (QRF07_14725) | 3090474..3092123 | + | 1650 | WP_031653623.1 | CocE/NonD family hydrolase | - |
QRF07_RS14730 (QRF07_14730) | 3092225..3092581 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
QRF07_RS14735 (QRF07_14735) | 3092565..3092795 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
QRF07_RS14740 (QRF07_14740) | 3092838..3093881 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
QRF07_RS14745 (QRF07_14745) | 3093880..3094347 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
QRF07_RS14750 (QRF07_14750) | 3094523..3094777 | - | 255 | WP_003917684.1 | hypothetical protein | - |
QRF07_RS14755 (QRF07_14755) | 3094925..3095329 | + | 405 | WP_003414181.1 | hypothetical protein | - |
QRF07_RS14760 (QRF07_14760) | 3095326..3095517 | + | 192 | WP_003414184.1 | hypothetical protein | - |
QRF07_RS14765 (QRF07_14765) | 3095734..3095994 | + | 261 | Protein_2914 | transposase | - |
QRF07_RS14770 (QRF07_14770) | 3097104..3097361 | + | 258 | WP_003899489.1 | hypothetical protein | - |
QRF07_RS14775 (QRF07_14775) | 3097466..3097777 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T284040 WP_003414166.1 NZ_CP127277:c3092581-3092225 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|