Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3052228..3052907 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF90 |
Locus tag | QRF07_RS14500 | Protein ID | WP_003414059.1 |
Coordinates | 3052228..3052644 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | QRF07_RS14505 | Protein ID | WP_003414061.1 |
Coordinates | 3052641..3052907 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS14480 (QRF07_14480) | 3048280..3049182 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QRF07_RS14485 (QRF07_14485) | 3049251..3050003 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
QRF07_RS14490 (QRF07_14490) | 3050247..3050522 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
QRF07_RS14495 (QRF07_14495) | 3050519..3052141 | - | 1623 | WP_003414057.1 | class I SAM-dependent DNA methyltransferase | - |
QRF07_RS14500 (QRF07_14500) | 3052228..3052644 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
QRF07_RS14505 (QRF07_14505) | 3052641..3052907 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF07_RS14510 (QRF07_14510) | 3052933..3053328 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF07_RS14515 (QRF07_14515) | 3053325..3053594 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF07_RS14520 (QRF07_14520) | 3053604..3054698 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
QRF07_RS14525 (QRF07_14525) | 3054695..3055114 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
QRF07_RS14530 (QRF07_14530) | 3055113..3055187 | + | 75 | Protein_2867 | hypothetical protein | - |
QRF07_RS14535 (QRF07_14535) | 3055188..3055667 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
QRF07_RS14540 (QRF07_14540) | 3055738..3056538 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
QRF07_RS14545 (QRF07_14545) | 3056694..3057431 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T284038 WP_003414059.1 NZ_CP127277:c3052644-3052228 [Mycobacterium tuberculosis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|