Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2912128..2912842 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQK0 |
Locus tag | QRF07_RS13680 | Protein ID | WP_003413460.1 |
Coordinates | 2912402..2912842 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ20 |
Locus tag | QRF07_RS13675 | Protein ID | WP_003413456.1 |
Coordinates | 2912128..2912415 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS13640 (QRF07_13640) | 2907550..2907795 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
QRF07_RS13645 (QRF07_13645) | 2907792..2908196 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF07_RS13650 (QRF07_13650) | 2908413..2909033 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
QRF07_RS13655 (QRF07_13655) | 2909044..2909538 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
QRF07_RS13660 (QRF07_13660) | 2909535..2909966 | + | 432 | WP_003899390.1 | DUF4247 domain-containing protein | - |
QRF07_RS13665 (QRF07_13665) | 2909991..2910449 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
QRF07_RS13670 (QRF07_13670) | 2910446..2912017 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
QRF07_RS13675 (QRF07_13675) | 2912128..2912415 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
QRF07_RS13680 (QRF07_13680) | 2912402..2912842 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS13685 (QRF07_13685) | 2912863..2913618 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
QRF07_RS13690 (QRF07_13690) | 2913751..2914347 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
QRF07_RS13695 (QRF07_13695) | 2914355..2915200 | - | 846 | WP_031653622.1 | acyl-CoA thioesterase II | - |
QRF07_RS13700 (QRF07_13700) | 2915229..2916128 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
QRF07_RS13705 (QRF07_13705) | 2916256..2916930 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T284036 WP_003413460.1 NZ_CP127277:2912402-2912842 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQK0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BWB8 |