Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2912128..2912842 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag QRF07_RS13680 Protein ID WP_003413460.1
Coordinates 2912402..2912842 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag QRF07_RS13675 Protein ID WP_003413456.1
Coordinates 2912128..2912415 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS13640 (QRF07_13640) 2907550..2907795 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QRF07_RS13645 (QRF07_13645) 2907792..2908196 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
QRF07_RS13650 (QRF07_13650) 2908413..2909033 + 621 WP_003413441.1 DUF4178 domain-containing protein -
QRF07_RS13655 (QRF07_13655) 2909044..2909538 + 495 WP_003413444.1 DUF2617 family protein -
QRF07_RS13660 (QRF07_13660) 2909535..2909966 + 432 WP_003899390.1 DUF4247 domain-containing protein -
QRF07_RS13665 (QRF07_13665) 2909991..2910449 + 459 WP_003413451.1 DUF350 domain-containing protein -
QRF07_RS13670 (QRF07_13670) 2910446..2912017 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
QRF07_RS13675 (QRF07_13675) 2912128..2912415 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
QRF07_RS13680 (QRF07_13680) 2912402..2912842 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF07_RS13685 (QRF07_13685) 2912863..2913618 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
QRF07_RS13690 (QRF07_13690) 2913751..2914347 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
QRF07_RS13695 (QRF07_13695) 2914355..2915200 - 846 WP_031653622.1 acyl-CoA thioesterase II -
QRF07_RS13700 (QRF07_13700) 2915229..2916128 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
QRF07_RS13705 (QRF07_13705) 2916256..2916930 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T284036 WP_003413460.1 NZ_CP127277:2912402-2912842 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT284036 WP_003413456.1 NZ_CP127277:2912128-2912415 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References