Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 2850664..2851295 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ28 |
Locus tag | QRF07_RS13405 | Protein ID | WP_003413174.1 |
Coordinates | 2850918..2851295 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P95006 |
Locus tag | QRF07_RS13400 | Protein ID | WP_003413167.1 |
Coordinates | 2850664..2850921 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS13370 (QRF07_13370) | 2846578..2846892 | + | 315 | WP_009937839.1 | hypothetical protein | - |
QRF07_RS13375 (QRF07_13375) | 2847188..2848399 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
QRF07_RS13380 (QRF07_13380) | 2848526..2849185 | + | 660 | WP_285978957.1 | LppA family lipoprotein | - |
QRF07_RS13385 (QRF07_13385) | 2849182..2849844 | + | 663 | WP_286027199.1 | LppA family lipoprotein | - |
QRF07_RS13390 (QRF07_13390) | 2849841..2850119 | + | 279 | WP_041018915.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF07_RS13395 (QRF07_13395) | 2850212..2850625 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
QRF07_RS13400 (QRF07_13400) | 2850664..2850921 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
QRF07_RS13405 (QRF07_13405) | 2850918..2851295 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS13410 (QRF07_13410) | 2851311..2851685 | - | 375 | WP_003413177.1 | hypothetical protein | - |
QRF07_RS13415 (QRF07_13415) | 2851785..2852180 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
QRF07_RS13420 (QRF07_13420) | 2852177..2852422 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
QRF07_RS13425 (QRF07_13425) | 2852833..2853252 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
QRF07_RS13430 (QRF07_13430) | 2853264..2854073 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
QRF07_RS13435 (QRF07_13435) | 2854070..2855323 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
QRF07_RS13440 (QRF07_13440) | 2855316..2855828 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T284034 WP_003413174.1 NZ_CP127277:2850918-2851295 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ28 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C9W5 |