Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2850212..2850921 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag QRF07_RS13395 Protein ID WP_003413164.1
Coordinates 2850212..2850625 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag QRF07_RS13400 Protein ID WP_003413167.1
Coordinates 2850664..2850921 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS13365 (QRF07_13365) 2845265..2846470 - 1206 WP_003413027.1 chorismate synthase -
QRF07_RS13370 (QRF07_13370) 2846578..2846892 + 315 WP_009937839.1 hypothetical protein -
QRF07_RS13375 (QRF07_13375) 2847188..2848399 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
QRF07_RS13380 (QRF07_13380) 2848526..2849185 + 660 WP_285978957.1 LppA family lipoprotein -
QRF07_RS13385 (QRF07_13385) 2849182..2849844 + 663 WP_286027199.1 LppA family lipoprotein -
QRF07_RS13390 (QRF07_13390) 2849841..2850119 + 279 WP_041018915.1 type II toxin-antitoxin system VapB family antitoxin -
QRF07_RS13395 (QRF07_13395) 2850212..2850625 + 414 WP_003413164.1 PIN domain nuclease Toxin
QRF07_RS13400 (QRF07_13400) 2850664..2850921 + 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
QRF07_RS13405 (QRF07_13405) 2850918..2851295 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
QRF07_RS13410 (QRF07_13410) 2851311..2851685 - 375 WP_003413177.1 hypothetical protein -
QRF07_RS13415 (QRF07_13415) 2851785..2852180 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
QRF07_RS13420 (QRF07_13420) 2852177..2852422 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
QRF07_RS13425 (QRF07_13425) 2852833..2853252 - 420 WP_003413190.1 A24 family peptidase -
QRF07_RS13430 (QRF07_13430) 2853264..2854073 - 810 WP_003413193.1 shikimate dehydrogenase -
QRF07_RS13435 (QRF07_13435) 2854070..2855323 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
QRF07_RS13440 (QRF07_13440) 2855316..2855828 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T284033 WP_003413164.1 NZ_CP127277:2850212-2850625 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT284033 WP_003413167.1 NZ_CP127277:2850664-2850921 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References