Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2836325..2836965 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | QRF07_RS13310 | Protein ID | WP_003412970.1 |
Coordinates | 2836325..2836744 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | QRF07_RS13315 | Protein ID | WP_003412975.1 |
Coordinates | 2836741..2836965 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS13280 (QRF07_13280) | 2831910..2832632 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
QRF07_RS13285 (QRF07_13285) | 2833149..2833376 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
QRF07_RS13290 (QRF07_13290) | 2833373..2833774 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
QRF07_RS13295 (QRF07_13295) | 2833809..2834729 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
QRF07_RS13300 (QRF07_13300) | 2835070..2835315 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
QRF07_RS13305 (QRF07_13305) | 2835374..2836324 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
QRF07_RS13310 (QRF07_13310) | 2836325..2836744 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS13315 (QRF07_13315) | 2836741..2836965 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
QRF07_RS13320 (QRF07_13320) | 2836996..2839839 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
QRF07_RS13325 (QRF07_13325) | 2839911..2840312 | - | 402 | WP_003412981.1 | hypothetical protein | - |
QRF07_RS13330 (QRF07_13330) | 2840312..2840782 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
QRF07_RS13335 (QRF07_13335) | 2840785..2841348 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T284032 WP_003412970.1 NZ_CP127277:c2836744-2836325 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|