Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2836325..2836965 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag QRF07_RS13310 Protein ID WP_003412970.1
Coordinates 2836325..2836744 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag QRF07_RS13315 Protein ID WP_003412975.1
Coordinates 2836741..2836965 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS13280 (QRF07_13280) 2831910..2832632 - 723 WP_003412957.1 DUF1906 domain-containing protein -
QRF07_RS13285 (QRF07_13285) 2833149..2833376 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
QRF07_RS13290 (QRF07_13290) 2833373..2833774 + 402 WP_003412963.1 PIN domain-containing protein -
QRF07_RS13295 (QRF07_13295) 2833809..2834729 - 921 WP_003412965.1 restriction endonuclease -
QRF07_RS13300 (QRF07_13300) 2835070..2835315 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
QRF07_RS13305 (QRF07_13305) 2835374..2836324 + 951 WP_003911916.1 ERCC4 domain-containing protein -
QRF07_RS13310 (QRF07_13310) 2836325..2836744 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF07_RS13315 (QRF07_13315) 2836741..2836965 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
QRF07_RS13320 (QRF07_13320) 2836996..2839839 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
QRF07_RS13325 (QRF07_13325) 2839911..2840312 - 402 WP_003412981.1 hypothetical protein -
QRF07_RS13330 (QRF07_13330) 2840312..2840782 - 471 WP_003899364.1 transcription antitermination factor NusB -
QRF07_RS13335 (QRF07_13335) 2840785..2841348 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T284032 WP_003412970.1 NZ_CP127277:c2836744-2836325 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT284032 WP_003412975.1 NZ_CP127277:c2836965-2836741 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References