Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2790141..2790793 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A5R1ZCY8 |
Locus tag | QRF07_RS13115 | Protein ID | WP_003905869.1 |
Coordinates | 2790368..2790793 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | QRF07_RS13110 | Protein ID | WP_003412749.1 |
Coordinates | 2790141..2790362 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS13095 (QRF07_13095) | 2788381..2788587 | - | 207 | WP_003899347.1 | hypothetical protein | - |
QRF07_RS13100 (QRF07_13100) | 2788723..2789346 | + | 624 | WP_003900858.1 | TIGR00725 family protein | - |
QRF07_RS13105 (QRF07_13105) | 2789336..2790088 | + | 753 | WP_003901416.1 | hypothetical protein | - |
QRF07_RS13110 (QRF07_13110) | 2790141..2790362 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
QRF07_RS13115 (QRF07_13115) | 2790368..2790793 | + | 426 | WP_003905869.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS13120 (QRF07_13120) | 2790816..2791997 | - | 1182 | WP_003905870.1 | dihydrolipoamide acetyltransferase family protein | - |
QRF07_RS13125 (QRF07_13125) | 2791994..2793040 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
QRF07_RS13130 (QRF07_13130) | 2793051..2794154 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
QRF07_RS13135 (QRF07_13135) | 2794413..2795234 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
QRF07_RS13140 (QRF07_13140) | 2795231..2795788 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15364.84 Da Isoelectric Point: 9.2386
>T284031 WP_003905869.1 NZ_CP127277:2790368-2790793 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRASTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRASTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5R1ZCY8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |