Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 2240666..2241292 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | QRF07_RS10510 | Protein ID | WP_003410075.1 |
Coordinates | 2240894..2241292 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | QRF07_RS10505 | Protein ID | WP_003911750.1 |
Coordinates | 2240666..2240893 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS10495 (QRF07_10495) | 2238705..2239049 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
QRF07_RS10500 (QRF07_10500) | 2239238..2240407 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
QRF07_RS10505 (QRF07_10505) | 2240666..2240893 | + | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF07_RS10510 (QRF07_10510) | 2240894..2241292 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
QRF07_RS10515 (QRF07_10515) | 2241475..2241906 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
QRF07_RS10520 (QRF07_10520) | 2242007..2242441 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
QRF07_RS10525 (QRF07_10525) | 2242878..2243057 | - | 180 | Protein_2080 | hypothetical protein | - |
QRF07_RS10530 (QRF07_10530) | 2243145..2243765 | + | 621 | WP_003410086.1 | IS110 family transposase | - |
QRF07_RS10535 (QRF07_10535) | 2243719..2244309 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
QRF07_RS10540 (QRF07_10540) | 2244437..2245693 | - | 1257 | WP_003902247.1 | HNH endonuclease signature motif containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T284026 WP_003410075.1 NZ_CP127277:2240894-2241292 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|