Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2216926..2217512 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | QRF07_RS10405 | Protein ID | WP_003410010.1 |
Coordinates | 2216926..2217270 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | QRF07_RS10410 | Protein ID | WP_003410014.1 |
Coordinates | 2217264..2217512 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS10370 (QRF07_10370) | 2212632..2213231 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
QRF07_RS10375 (QRF07_10375) | 2213647..2214075 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
QRF07_RS10380 (QRF07_10380) | 2214301..2214840 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
QRF07_RS10385 (QRF07_10385) | 2215360..2215920 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
QRF07_RS10390 (QRF07_10390) | 2215917..2216258 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
QRF07_RS10395 (QRF07_10395) | 2216344..2216601 | + | 258 | WP_003410006.1 | hypothetical protein | - |
QRF07_RS10400 (QRF07_10400) | 2216502..2216837 | - | 336 | WP_003410009.1 | dehydrogenase | - |
QRF07_RS10405 (QRF07_10405) | 2216926..2217270 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
QRF07_RS10410 (QRF07_10410) | 2217264..2217512 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QRF07_RS10415 (QRF07_10415) | 2217612..2219927 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
QRF07_RS10420 (QRF07_10420) | 2219924..2220196 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
QRF07_RS10425 (QRF07_10425) | 2220249..2220605 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
QRF07_RS10430 (QRF07_10430) | 2220762..2221529 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T284025 WP_003410010.1 NZ_CP127277:c2217270-2216926 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5HK3 | |
PDB | 5HK0 | |
PDB | 5HKC |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAW9 |