Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2208034..2208722 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | QRF07_RS10340 | Protein ID | WP_003409958.1 |
Coordinates | 2208034..2208453 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | QRF07_RS10345 | Protein ID | WP_003409968.1 |
Coordinates | 2208462..2208722 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS10320 (QRF07_10320) | 2203529..2204377 | + | 849 | WP_003901306.1 | class I SAM-dependent methyltransferase | - |
QRF07_RS10325 (QRF07_10325) | 2204340..2205785 | - | 1446 | WP_003899115.1 | APC family permease | - |
QRF07_RS10330 (QRF07_10330) | 2205964..2206650 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
QRF07_RS10335 (QRF07_10335) | 2206841..2207809 | - | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
QRF07_RS10340 (QRF07_10340) | 2208034..2208453 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS10345 (QRF07_10345) | 2208462..2208722 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF07_RS10350 (QRF07_10350) | 2208865..2210541 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
QRF07_RS10355 (QRF07_10355) | 2210529..2211182 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
QRF07_RS10360 (QRF07_10360) | 2211297..2211527 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
QRF07_RS10365 (QRF07_10365) | 2211612..2212523 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
QRF07_RS10370 (QRF07_10370) | 2212632..2213231 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T284023 WP_003409958.1 NZ_CP127277:c2208453-2208034 [Mycobacterium tuberculosis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |