Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2186302..2186846 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag QRF07_RS10220 Protein ID WP_003409896.1
Coordinates 2186302..2186598 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag QRF07_RS10225 Protein ID WP_003409899.1
Coordinates 2186595..2186846 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS10165 (QRF07_10165) 2181335..2181685 - 351 WP_003409871.1 hypothetical protein -
QRF07_RS10170 (QRF07_10170) 2181696..2182598 - 903 WP_003899097.1 hypothetical protein -
QRF07_RS10175 (QRF07_10175) 2182619..2182810 - 192 WP_003409876.1 hypothetical protein -
QRF07_RS10180 (QRF07_10180) 2182811..2183107 - 297 WP_003409877.1 hypothetical protein -
QRF07_RS10185 (QRF07_10185) 2183347..2183562 + 216 WP_003409878.1 antitoxin -
QRF07_RS10190 (QRF07_10190) 2183559..2183870 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
QRF07_RS10195 (QRF07_10195) 2183844..2184365 - 522 WP_003904745.1 hypothetical protein -
QRF07_RS10200 (QRF07_10200) 2184340..2184717 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
QRF07_RS10205 (QRF07_10205) 2184759..2185208 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
QRF07_RS10210 (QRF07_10210) 2185205..2185750 + 546 WP_003409891.1 SecB-like chaperone -
QRF07_RS10215 (QRF07_10215) 2185639..2186253 - 615 WP_003901296.1 hypothetical protein -
QRF07_RS10220 (QRF07_10220) 2186302..2186598 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QRF07_RS10225 (QRF07_10225) 2186595..2186846 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
QRF07_RS10230 (QRF07_10230) 2186833..2187327 + 495 WP_003899099.1 hypothetical protein -
QRF07_RS10235 (QRF07_10235) 2187487..2187894 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
QRF07_RS10240 (QRF07_10240) 2187898..2188170 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QRF07_RS10245 (QRF07_10245) 2188203..2189423 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
QRF07_RS10250 (QRF07_10250) 2190321..2191118 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T284022 WP_003409896.1 NZ_CP127277:c2186598-2186302 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT284022 WP_003409899.1 NZ_CP127277:c2186846-2186595 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References