Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2177265..2177968 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | QRF07_RS10130 | Protein ID | WP_003409778.1 |
Coordinates | 2177265..2177594 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | QRF07_RS10135 | Protein ID | WP_003409780.1 |
Coordinates | 2177591..2177968 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS10110 (QRF07_10110) | 2173648..2174718 | + | 1071 | WP_003902252.1 | epoxide hydrolase EphB | - |
QRF07_RS10115 (QRF07_10115) | 2174715..2175230 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
QRF07_RS10120 (QRF07_10120) | 2175227..2176288 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
QRF07_RS10125 (QRF07_10125) | 2176285..2177055 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
QRF07_RS10130 (QRF07_10130) | 2177265..2177594 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QRF07_RS10135 (QRF07_10135) | 2177591..2177968 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
QRF07_RS10140 (QRF07_10140) | 2177965..2178555 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
QRF07_RS10145 (QRF07_10145) | 2178610..2179974 | + | 1365 | WP_003903691.1 | HNH endonuclease signature motif containing protein | - |
QRF07_RS10150 (QRF07_10150) | 2180129..2180581 | - | 453 | WP_003899095.1 | lipoprotein | - |
QRF07_RS10155 (QRF07_10155) | 2180645..2181046 | + | 402 | WP_003409869.1 | hypothetical protein | - |
QRF07_RS10160 (QRF07_10160) | 2181039..2181221 | - | 183 | WP_003409870.1 | hypothetical protein | - |
QRF07_RS10165 (QRF07_10165) | 2181335..2181685 | - | 351 | WP_003409871.1 | hypothetical protein | - |
QRF07_RS10170 (QRF07_10170) | 2181696..2182598 | - | 903 | WP_003899097.1 | hypothetical protein | - |
QRF07_RS10175 (QRF07_10175) | 2182619..2182810 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T284020 WP_003409778.1 NZ_CP127277:c2177594-2177265 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT284020 WP_003409780.1 NZ_CP127277:c2177968-2177591 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|