Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 1388322..1388881 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0THS1 |
Locus tag | QRF07_RS06640 | Protein ID | WP_003898789.1 |
Coordinates | 1388322..1388615 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0THS2 |
Locus tag | QRF07_RS06645 | Protein ID | WP_003406322.1 |
Coordinates | 1388612..1388881 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS06615 (QRF07_06615) | 1383915..1384175 | + | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
QRF07_RS06620 (QRF07_06620) | 1384172..1384603 | + | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF07_RS06625 (QRF07_06625) | 1384626..1386314 | - | 1689 | WP_286027218.1 | PE family protein | - |
QRF07_RS06630 (QRF07_06630) | 1386494..1387354 | + | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
QRF07_RS06635 (QRF07_06635) | 1387435..1388265 | - | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
QRF07_RS06640 (QRF07_06640) | 1388322..1388615 | - | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
QRF07_RS06645 (QRF07_06645) | 1388612..1388881 | - | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRF07_RS06650 (QRF07_06650) | 1388994..1392689 | - | 3696 | WP_003406323.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
QRF07_RS06655 (QRF07_06655) | 1392831..1393619 | - | 789 | WP_003406325.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T284013 WP_003898789.1 NZ_CP127277:c1388615-1388322 [Mycobacterium tuberculosis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|