Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1239053..1239621 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TH08 |
Locus tag | QRF07_RS05945 | Protein ID | WP_003405865.1 |
Coordinates | 1239247..1239621 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TH07 |
Locus tag | QRF07_RS05940 | Protein ID | WP_003405863.1 |
Coordinates | 1239053..1239250 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS05920 (QRF07_05920) | 1235094..1235732 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
QRF07_RS05925 (QRF07_05925) | 1235822..1236829 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
QRF07_RS05930 (QRF07_05930) | 1236846..1237829 | - | 984 | WP_003898731.1 | hypothetical protein | - |
QRF07_RS05935 (QRF07_05935) | 1237892..1238965 | + | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
QRF07_RS05940 (QRF07_05940) | 1239053..1239250 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QRF07_RS05945 (QRF07_05945) | 1239247..1239621 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS05950 (QRF07_05950) | 1239824..1240522 | + | 699 | WP_003898733.1 | hypothetical protein | - |
QRF07_RS05955 (QRF07_05955) | 1240640..1240825 | + | 186 | WP_003901093.1 | hypothetical protein | - |
QRF07_RS05960 (QRF07_05960) | 1240752..1241027 | - | 276 | WP_003405867.1 | hypothetical protein | - |
QRF07_RS05965 (QRF07_05965) | 1241270..1241593 | + | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
QRF07_RS05970 (QRF07_05970) | 1241608..1242306 | - | 699 | WP_031646953.1 | hypothetical protein | - |
QRF07_RS05975 (QRF07_05975) | 1242340..1242549 | + | 210 | WP_003911400.1 | hypothetical protein | - |
QRF07_RS05980 (QRF07_05980) | 1242501..1243271 | - | 771 | Protein_1178 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T284011 WP_003405865.1 NZ_CP127277:1239247-1239621 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|