Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 717662..718326 | Replicon | chromosome |
Accession | NZ_CP127277 | ||
Organism | Mycobacterium tuberculosis strain 25421 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P96917 |
Locus tag | QRF07_RS03300 | Protein ID | WP_003403246.1 |
Coordinates | 717919..718326 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WF18 |
Locus tag | QRF07_RS03295 | Protein ID | WP_003403244.1 |
Coordinates | 717662..717922 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF07_RS03270 (QRF07_03270) | 713839..714903 | + | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
QRF07_RS03275 (QRF07_03275) | 715007..715954 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
QRF07_RS03280 (QRF07_03280) | 716047..716301 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
QRF07_RS03285 (QRF07_03285) | 716301..716696 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
QRF07_RS03290 (QRF07_03290) | 716790..717530 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
QRF07_RS03295 (QRF07_03295) | 717662..717922 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QRF07_RS03300 (QRF07_03300) | 717919..718326 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF07_RS03305 (QRF07_03305) | 718398..719549 | - | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
QRF07_RS03310 (QRF07_03310) | 719642..721369 | - | 1728 | WP_286027213.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T284001 WP_003403246.1 NZ_CP127277:717919-718326 [Mycobacterium tuberculosis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3DBO | |
AlphaFold DB | A0A7U4BSE4 |