Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 696791..697437 Replicon chromosome
Accession NZ_CP127277
Organism Mycobacterium tuberculosis strain 25421

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag QRF07_RS03145 Protein ID WP_003403137.1
Coordinates 696791..697204 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag QRF07_RS03150 Protein ID WP_003403139.1
Coordinates 697201..697437 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QRF07_RS03125 (QRF07_03125) 692874..694424 + 1551 WP_003905349.1 MCE family protein -
QRF07_RS03130 (QRF07_03130) 694476..694868 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
QRF07_RS03135 (QRF07_03135) 694865..695122 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
QRF07_RS03140 (QRF07_03140) 695305..696540 - 1236 WP_003403128.1 ATP-binding protein -
QRF07_RS03145 (QRF07_03145) 696791..697204 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
QRF07_RS03150 (QRF07_03150) 697201..697437 - 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 Antitoxin
QRF07_RS03155 (QRF07_03155) 697541..698047 - 507 WP_003900973.1 two component system sensor kinase HK1 -
QRF07_RS03160 (QRF07_03160) 698161..698691 - 531 WP_003917320.1 two component system sensor kinase HK2 -
QRF07_RS03165 (QRF07_03165) 698675..699370 - 696 WP_003918099.1 two-component system response regulator TcrA -
QRF07_RS03170 (QRF07_03170) 699493..699804 + 312 WP_003403164.1 hypothetical protein -
QRF07_RS03175 (QRF07_03175) 699876..700826 + 951 WP_003900184.1 DUF1259 domain-containing protein -
QRF07_RS03180 (QRF07_03180) 701067..701651 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
QRF07_RS03185 (QRF07_03185) 701653..702363 + 711 Protein_631 IS607 family element RNA-guided endonuclease TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T283997 WP_003403137.1 NZ_CP127277:c697204-696791 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT283997 WP_003403139.1 NZ_CP127277:c697437-697201 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References