Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-PHD |
| Location | 3810982..3811667 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TIR9 |
| Locus tag | QRF08_RS17990 | Protein ID | WP_003417998.1 |
| Coordinates | 3811257..3811667 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QRF08_RS17985 | Protein ID | WP_180895138.1 |
| Coordinates | 3810982..3811260 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS17965 (QRF08_17965) | 3806971..3808572 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
| QRF08_RS17970 (QRF08_17970) | 3808589..3809293 | - | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
| QRF08_RS17975 (QRF08_17975) | 3809411..3809977 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
| QRF08_RS17980 (QRF08_17980) | 3810039..3810926 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
| QRF08_RS17985 (QRF08_17985) | 3810982..3811260 | + | 279 | WP_180895138.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QRF08_RS17990 (QRF08_17990) | 3811257..3811667 | + | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF08_RS17995 (QRF08_17995) | 3811700..3813436 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
| QRF08_RS18000 (QRF08_18000) | 3813492..3814619 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
| QRF08_RS18005 (QRF08_18005) | 3814639..3816228 | - | 1590 | WP_003901630.1 | IMP dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T283988 WP_003417998.1 NZ_CP127276:3811257-3811667 [Mycobacterium tuberculosis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|