Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3692351..3693025 | Replicon | chromosome |
| Accession | NZ_CP127276 | ||
| Organism | Mycobacterium tuberculosis strain 5521 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF52 |
| Locus tag | QRF08_RS17530 | Protein ID | WP_003417282.1 |
| Coordinates | 3692351..3692779 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TI59 |
| Locus tag | QRF08_RS17535 | Protein ID | WP_003417286.1 |
| Coordinates | 3692783..3693025 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRF08_RS17505 (QRF08_17505) | 3688173..3688574 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
| QRF08_RS17510 (QRF08_17510) | 3688811..3689149 | + | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
| QRF08_RS17515 (QRF08_17515) | 3689146..3689580 | + | 435 | WP_003902441.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
| QRF08_RS17520 (QRF08_17520) | 3689709..3691481 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
| QRF08_RS17525 (QRF08_17525) | 3691481..3692272 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
| QRF08_RS17530 (QRF08_17530) | 3692351..3692779 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QRF08_RS17535 (QRF08_17535) | 3692783..3693025 | - | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
| QRF08_RS17540 (QRF08_17540) | 3693147..3693761 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
| QRF08_RS17545 (QRF08_17545) | 3693758..3694423 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
| QRF08_RS17550 (QRF08_17550) | 3694424..3694957 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
| QRF08_RS17555 (QRF08_17555) | 3694954..3695088 | - | 135 | Protein_3467 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
| QRF08_RS17560 (QRF08_17560) | 3695142..3696403 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T283985 WP_003417282.1 NZ_CP127276:c3692779-3692351 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FBL0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TI59 |