Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3167847..3168534 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | QRF08_RS15145 | Protein ID | WP_003414624.1 |
Coordinates | 3168091..3168534 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | QRF08_RS15140 | Protein ID | WP_003414620.1 |
Coordinates | 3167847..3168104 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS15120 (QRF08_15120) | 3163167..3164021 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
QRF08_RS15125 (QRF08_15125) | 3164077..3165240 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
QRF08_RS15130 (QRF08_15130) | 3165257..3166471 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
QRF08_RS15135 (QRF08_15135) | 3166479..3167720 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
QRF08_RS15140 (QRF08_15140) | 3167847..3168104 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
QRF08_RS15145 (QRF08_15145) | 3168091..3168534 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QRF08_RS15150 (QRF08_15150) | 3168614..3169276 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
QRF08_RS15155 (QRF08_15155) | 3169372..3169563 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
QRF08_RS15160 (QRF08_15160) | 3169895..3171643 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
QRF08_RS15165 (QRF08_15165) | 3171739..3172320 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
QRF08_RS15170 (QRF08_15170) | 3172420..3172686 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T283983 WP_003414624.1 NZ_CP127276:3168091-3168534 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|