Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3162246..3162794 | Replicon | chromosome |
Accession | NZ_CP127276 | ||
Organism | Mycobacterium tuberculosis strain 5521 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | QRF08_RS15115 | Protein ID | WP_003414602.1 |
Coordinates | 3162531..3162794 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | QRF08_RS15110 | Protein ID | WP_003414599.1 |
Coordinates | 3162246..3162527 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRF08_RS15085 (QRF08_15085) | 3157869..3158726 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
QRF08_RS15090 (QRF08_15090) | 3158768..3159352 | - | 585 | WP_003414585.1 | DUF1707 domain-containing protein | - |
QRF08_RS15095 (QRF08_15095) | 3159456..3159704 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
QRF08_RS15100 (QRF08_15100) | 3159701..3160081 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
QRF08_RS15105 (QRF08_15105) | 3160163..3161974 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
QRF08_RS15110 (QRF08_15110) | 3162246..3162527 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
QRF08_RS15115 (QRF08_15115) | 3162531..3162794 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QRF08_RS15120 (QRF08_15120) | 3163167..3164021 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
QRF08_RS15125 (QRF08_15125) | 3164077..3165240 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
QRF08_RS15130 (QRF08_15130) | 3165257..3166471 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
QRF08_RS15135 (QRF08_15135) | 3166479..3167720 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T283982 WP_003414602.1 NZ_CP127276:3162531-3162794 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3G5O | |
AlphaFold DB | A0A7U4BWP8 |